PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009601281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 721aa    MW: 81696.8 Da    PI: 6.3568
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009601281.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK461.1e-14534577346
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPh 46 
                     ++i+l++++   s++  +AA +Lgv+ ++LKriCR yGI RWP 
  XP_009601281.1 534 HNINLKKIEDRSSMTQDAAADDLGVGKSTLKRICRLYGITRWPP 577
                     799****************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.946520610IPR003035RWP-RK domain
PfamPF020427.4E-12535578IPR003035RWP-RK domain
SuperFamilySSF542772.68E-13636719No hitNo description
Gene3DG3DSA:3.10.20.2402.6E-13637715No hitNo description
PROSITE profilePS5174518.834638720IPR000270PB1 domain
SMARTSM006664.5E-13638720IPR000270PB1 domain
PfamPF005643.3E-13641719IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MESVFSEQAW SRQPNGIWVF WSERDDVEQL QNHFSFNVVT KRMAIKERVK IALQHVEKLS  60
CNYLIQYWAS IVIDGQTFLT TSDQPFGLTR LEYGLCSYRK KCLSHAIPVE LKNGTQCEND  120
FGPPGRVFKH RLPELCTDVK NYSQQEFPLR DDAVAWGIQW CYTVPVFDSS RDTFVGVLEL  180
VTSHQTNKWI FQNSVLPIFK TLQVVDLKSP DSYCPLNLKV LDDRQCALGG LYKAIEVVCQ  240
KHQFLFAQIW VSVADSWCTG KAITVRQRHI AINDNQNLSL FKYASGLQYI LEGYGVVGRA  300
FSSKSSCFCR DVTQLSIIEY PLVTCAREAG LTGCFAICLS APGNDDNIYI LEFFLPPNEL  360
LHWNLQDFVK LVLDTVKQQL HRFKVAVGHD FGEKLPVEVI KISSDDELDS FDICQTTKEL  420
HNVEPLPNGG ELMLLDTPNQ QSFSSETNQQ LSLDIDEINA ARDSIAVSEE LCNSAGSSTS  480
AETSQNKERK LQLELSTRQA KQGANAVNKR KNGIRTLTSE SEIQKERERI ERDHNINLKK  540
IEDRSSMTQD AAADDLGVGK STLKRICRLY GITRWPPKNK EKKRKCSHSR KMKSILPAEE  600
DVNASTKFQQ SSDSPNKEDT INGAKVGAHV TEIRDGTAVI TKVKYGDRML KLQLTLSSMM  660
KDLEEEVAKR VESSIESFDF TYVDKEGDTI LIKCDEDLTE CFLHCRSSEN ATVKMFITPK  720
S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1576584PKNKEKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601281.10.0PREDICTED: protein NLP7-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.15e-55Nin-like family protein